CABS-dock: 5726955165f26d9

Project name: 5726955165f26d9

Status: done

submitted: 2026-07-28 09:48:37, status changed: 2026-07-28 11:41:07

Project settings

Protein sequence(s)	APYGARMPFGGQVPLGAPPPFPTWPGCPQPPPLHAWQAGTPPPPSPQPAAFPQSLPFPQSPAFPTASPAPPQSPGLQPLIIHHAQMVQLGLNNHMWNQRGSQAPEDKTQEAE input pdb
Peptide sequence	FVQVGDNNY
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	23.9367	6.05763	32.5618	145
cluster_2.pdb ( medoid)	22.0593	8.25047	27.4154	182
cluster_3.pdb ( medoid)	14.2016	8.59059	29.8619	122
cluster_4.pdb ( medoid)	13.0559	9.49761	33.2225	124
cluster_5.pdb ( medoid)	12.4449	7.39259	17.501	92
cluster_6.pdb ( medoid)	5.82352	11.6768	28.4168	68
cluster_7.pdb ( medoid)	5.76144	12.844	27.6167	74
cluster_8.pdb ( medoid)	5.60493	14.8084	34.5051	83
cluster_9.pdb ( medoid)	5.02811	13.3251	29.3706	67
cluster_10.pdb ( medoid)	2.51329	17.1091	38.5335	43