CABS-dock: 58d2e5193ee24c3

Project name: 58d2e5193ee24c3

Status: done

submitted: 2026-07-09 17:09:15, status changed: 2026-07-09 19:55:29

Project settings

Protein sequence(s)	VVIEKSCKCVKLKLPNNKVVDVLSPVLSEMYQWIQDSDEKPESGGYIVGYRHKETGHVSLETVSHPYLLDTQNRIRFNIKDPRHMFFLKKAKRKKSYYMGVWHTHPQRVPSPSSIDWADWADSLKEEKSGCEYIFFVIVGIEEWRVWVGDSQNGIISEIVECEKDKDGLYL input pdb
Peptide sequence	GLSPQNSIRH
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCCCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	36.3083	5.48083	16.5717	199
cluster_2.pdb ( medoid)	28.579	4.16389	16.6789	119
cluster_3.pdb ( medoid)	23.9933	4.08447	30.8333	98
cluster_4.pdb ( medoid)	17.858	6.49569	35.7061	116
cluster_5.pdb ( medoid)	16.1481	5.51148	15.3748	89
cluster_6.pdb ( medoid)	10.1987	10.4915	28.8751	107
cluster_7.pdb ( medoid)	9.67975	7.54152	24.4487	73
cluster_8.pdb ( medoid)	6.42286	8.25178	22.0134	53
cluster_9.pdb ( medoid)	6.04086	12.0844	37.5517	73
cluster_10.pdb ( medoid)	5.46557	13.3563	28.1464	73