Project name: 58d2e5193ee24c3

Status: done

submitted: 2026-07-09 17:09:15, status changed: 2026-07-09 19:55:29

Project settings
Protein sequence(s) VVIEKSCKCVKLKLPNNKVVDVLSPVLSEMYQWIQDSDEKPESGGYIVGYRHKETGHVSLETVSHPYLLDTQNRIRFNIKDPRHMFFLKKAKRKKSYYMGVWHTHPQRVPSPSSIDWADWADSLKEEKSGCEYIFFVIVGIEEWRVWVGDSQNGIISEIVECEKDKDGLYL input pdb
Peptide sequence GLSPQNSIRH
Simulation mc cycles50
Peptide secondary structure psipred CCCCCCCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 36.3083 5.48083 16.5717 199
cluster_2.pdb ( medoid) 28.579 4.16389 16.6789 119
cluster_3.pdb ( medoid) 23.9933 4.08447 30.8333 98
cluster_4.pdb ( medoid) 17.858 6.49569 35.7061 116
cluster_5.pdb ( medoid) 16.1481 5.51148 15.3748 89
cluster_6.pdb ( medoid) 10.1987 10.4915 28.8751 107
cluster_7.pdb ( medoid) 9.67975 7.54152 24.4487 73
cluster_8.pdb ( medoid) 6.42286 8.25178 22.0134 53
cluster_9.pdb ( medoid) 6.04086 12.0844 37.5517 73
cluster_10.pdb ( medoid) 5.46557 13.3563 28.1464 73