CABS-dock: 5d0120ab5ee39f2

Project name: 5d0120ab5ee39f2

Status: done

submitted: 2026-06-02 11:11:33, status changed: 2026-06-02 17:42:10

Project settings

Protein sequence(s)	DHCPLGPGRCCRLHTVRASLEDLGWADWVLSPREVQVTMCIGACPSQFRAANMHAQIKTSLHRLKPDTVPAPCCVPASYNPMVLIQKTDTGVSLQTYDDLLAKDCHCIWSCLEVAEACVGDVVCNAQLASYLKACSANGNPCDLKQCQAAIRFFYQNIPFNIAQMLAFCDCAQSDIPCQQSKEALHSKTCAVNMVPPPTCLSVIRSCQNDELCRRHYRTFQSKCWQRVTRKCHEDENCISTLSKQDLTCSGSDDCKAAYIDILGTVLQVQCTCRTITQSEESLCKIFQHMLHRKSCFN input pdb
Peptide sequence	NVKEDKFKWNLTTRSHH
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCCCCCCCCCCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	22.9688	4.09251	21.0285	94
cluster_2.pdb ( medoid)	22.0053	10.8156	48.1067	238
cluster_3.pdb ( medoid)	11.517	13.111	28.7907	151
cluster_4.pdb ( medoid)	11.3233	10.3327	39.9692	117
cluster_5.pdb ( medoid)	9.21064	8.68561	22.5315	80
cluster_6.pdb ( medoid)	6.65007	7.6691	21.5058	51
cluster_7.pdb ( medoid)	6.58377	13.67	38.3134	90
cluster_8.pdb ( medoid)	5.90313	10.5029	22.4943	62
cluster_9.pdb ( medoid)	5.20318	13.6455	32.8782	71
cluster_10.pdb ( medoid)	3.39996	13.5296	35.8154	46