Project name: 5e16e7746b14b43

Status: done

submitted: 2026-04-01 08:45:57, status changed: 2026-04-01 12:43:21

Project settings
Protein sequence(s) MVLSDKTPGSASYRISDNNFVQCGSNCTMIIDGDVVRGRPQDPGAAASPAKRLVQVFGNPTYRLHMVLSDKTPGSASYRISDNNFVQCGSNCTMIIDGDVVRGRPQDPGAAASPA input pdb
Peptide sequence NPVTGRPLVNIYNCSGVQVGDNNYLTMQQT
Simulation mc cycles50
Peptide secondary structure psipred CCCCCCCEEEEECCCCCEECCCCEEEEECC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 16.6322 7.8763 29.0709 131
cluster_2.pdb ( medoid) 13.0961 12.8283 35.5492 168
cluster_3.pdb ( medoid) 10.6765 17.4215 39.3734 186
cluster_4.pdb ( medoid) 10.4913 10.8662 30.3468 114
cluster_5.pdb ( medoid) 6.10756 12.4436 33.5016 76
cluster_6.pdb ( medoid) 5.1573 10.4706 33.3524 54
cluster_7.pdb ( medoid) 3.64403 24.1491 45.9059 88
cluster_8.pdb ( medoid) 3.32806 22.5357 42.8694 75
cluster_9.pdb ( medoid) 3.06243 21.225 45.6757 65
cluster_10.pdb ( medoid) 2.08604 20.6132 39.9763 43