CABS-dock: 5ebdef2f09a8e7b

Project name: 5ebdef2f09a8e7b

Status: done

submitted: 2026-07-01 10:05:28, status changed: 2026-07-01 14:47:45

Project settings

Protein sequence(s)	VKDFLSQLRSSNRRFSIPESGQGGTEMDGFRRTIENQHSRNDVMVSEWLNKLNLEEPPSSVPKKCPSLTKRSRAQEEQVPQAWTAGTSSDSMAQPPQTPETSTFRNQMPSPTSTGTPSPGPRGNQGAERQGMNWSCRTPEPNPVTGRPLVNIYNCSGVQVGDNNYLTMQQTTALPTWGLAPSGKGRGLQHPPPVGSQEGPKDPEAWSRPQGWYNHSGK input pdb
Peptide sequence	KRLVQVFGSNTYRLH
Simulation mc cycles	50
Peptide secondary structure psipred	CCCEEECCCCCEECC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	39.6124	2.80215	23.2175	111
cluster_2.pdb ( medoid)	23.3089	5.31986	29.5013	124
cluster_3.pdb ( medoid)	15.3225	8.81057	35.5823	135
cluster_4.pdb ( medoid)	12.5355	7.02008	20.6945	88
cluster_5.pdb ( medoid)	11.6167	10.2438	35.032	119
cluster_6.pdb ( medoid)	11.1933	14.0262	34.4765	157
cluster_7.pdb ( medoid)	5.49891	13.6391	32.5289	75
cluster_8.pdb ( medoid)	5.12658	14.4346	29.4256	74
cluster_9.pdb ( medoid)	3.94209	14.4594	29.4019	57
cluster_10.pdb ( medoid)	3.79802	15.7977	29.9275	60