Project name: 5ebdef2f09a8e7b

Status: done

submitted: 2026-07-01 10:05:28, status changed: 2026-07-01 14:47:45

Project settings
Protein sequence(s) VKDFLSQLRSSNRRFSIPESGQGGTEMDGFRRTIENQHSRNDVMVSEWLNKLNLEEPPSSVPKKCPSLTKRSRAQEEQVPQAWTAGTSSDSMAQPPQTPETSTFRNQMPSPTSTGTPSPGPRGNQGAERQGMNWSCRTPEPNPVTGRPLVNIYNCSGVQVGDNNYLTMQQTTALPTWGLAPSGKGRGLQHPPPVGSQEGPKDPEAWSRPQGWYNHSGK input pdb
Peptide sequence KRLVQVFGSNTYRLH
Simulation mc cycles50
Peptide secondary structure psipred CCCEEECCCCCEECC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 39.6124 2.80215 23.2175 111
cluster_2.pdb ( medoid) 23.3089 5.31986 29.5013 124
cluster_3.pdb ( medoid) 15.3225 8.81057 35.5823 135
cluster_4.pdb ( medoid) 12.5355 7.02008 20.6945 88
cluster_5.pdb ( medoid) 11.6167 10.2438 35.032 119
cluster_6.pdb ( medoid) 11.1933 14.0262 34.4765 157
cluster_7.pdb ( medoid) 5.49891 13.6391 32.5289 75
cluster_8.pdb ( medoid) 5.12658 14.4346 29.4256 74
cluster_9.pdb ( medoid) 3.94209 14.4594 29.4019 57
cluster_10.pdb ( medoid) 3.79802 15.7977 29.9275 60