Project name: CD44_RHOA_cytotail

Status: done

submitted: 2026-06-10 14:44:48, status changed: 2026-06-10 17:35:54

Project settings
Protein sequence(s) IRKKLVIVGDVACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQA input pdb
Peptide sequence NSRRRCGQKKKLVINSGNGAVEDRKPSGLN
Simulation mc cycles20
Peptide secondary structure psipred CCCCCCCCCCCEEEECCCCCCCCCCCCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 40.9874 3.48888 26.4309 143
cluster_2.pdb ( medoid) 20.4433 5.03832 30.5621 103
cluster_3.pdb ( medoid) 16.1098 10.863 35.499 175
cluster_4.pdb ( medoid) 16.1002 3.78878 6.81643 61
cluster_5.pdb ( medoid) 15.251 11.5403 34.725 176
cluster_6.pdb ( medoid) 11.2909 9.56521 28.4491 108
cluster_7.pdb ( medoid) 8.94855 11.7337 29.0873 105
cluster_8.pdb ( medoid) 6.77531 12.5456 28.2255 85
cluster_9.pdb ( medoid) 5.02298 5.3753 9.13708 27
cluster_10.pdb ( medoid) 1.34077 12.6793 21.5345 17