CABS-dock: 621ea3aab7dfae

Project name: 621ea3aab7dfae

Status: done

submitted: 2026-03-12 12:43:52, status changed: 2026-03-12 19:46:56

Project settings

Protein sequence(s)	VKDFLSQLRSSNRRFSIPESGQGGTEMDGFRRTIENQHSRNDVMVSEWLNKLNLEEPPSSVPKKCPSLTKRSRAQEEQVPQAWTAGTSSDSMAQPPQTPETSTFRNQMPSPTSTGTPSPGPRGNQGAERQGMNWSCRTPEPNPVTGRPLVNIYNCSGVQVGDNNYLTMQQTTALPTWGLAPSGKGRGLQHPPPVGSQEGPKDPEAWSRPQGWYNHSGK input pdb
Peptide sequence	RVQLFGSNR
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	25.6723	4.90801	22.3395	126
cluster_2.pdb ( medoid)	22.358	5.8592	24.2374	131
cluster_3.pdb ( medoid)	15.5067	9.7377	32.7958	151
cluster_4.pdb ( medoid)	10.3532	14.102	40.2072	146
cluster_5.pdb ( medoid)	9.18134	14.7037	46.4693	135
cluster_6.pdb ( medoid)	5.78715	9.84941	34.5084	57
cluster_7.pdb ( medoid)	5.36298	11.9337	35.216	64
cluster_8.pdb ( medoid)	4.76514	15.9492	36.8617	76
cluster_9.pdb ( medoid)	3.44966	15.074	37.3218	52
cluster_10.pdb ( medoid)	2.956	20.9743	51.8834	62