Project name: 2muh

Status: done

submitted: 2025-12-12 16:07:36, status changed: 2025-12-12 19:24:25

Project settings
Protein sequence(s) SSPSEGLCPPGHHISEDGRDCISCKYGQDYSTHWNDLLFCLRCTRCDSGEVELSPCTTTRNTVCQCEEGTFREEDSPEMCRKCRTGCPRGMVKVGDCTPWSDIECVHK input pdb
Peptide sequence RGGRLCYCRRRFCVCV
Simulation mc cycles50
Peptide secondary structure psipred CCCEEEEEECCEEEEC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 32.1192 3.51814 20.1388 113
cluster_2.pdb ( medoid) 23.0106 5.77995 23.3073 133
cluster_3.pdb ( medoid) 17.5942 9.09391 33.441 160
cluster_4.pdb ( medoid) 14.9581 7.95557 23.1129 119
cluster_5.pdb ( medoid) 10.3605 13.9955 37.0526 145
cluster_6.pdb ( medoid) 9.91639 11.7986 29.6917 117
cluster_7.pdb ( medoid) 5.95155 10.2494 25.0057 61
cluster_8.pdb ( medoid) 4.88478 9.00758 24.9657 44
cluster_9.pdb ( medoid) 4.39405 11.1514 22.1424 49
cluster_10.pdb ( medoid) 4.17742 14.1235 28.8988 59