CABS-dock: 62dadb5bb51b3a0

Project name: 62dadb5bb51b3a0

Status: done

submitted: 2026-03-13 10:27:55, status changed: 2026-03-13 13:14:09

Project settings

Protein sequence(s)	MVLSDKTPGSASYRISDNNFVQCGSNCTMIIDGDVVRGRPQDPGAAASPAMVLSDKTPGSASYRISDNNFVQCGSNCTMIIDGDVVRGRPQDPGAAASPA input pdb
Peptide sequence	RRMKWKKVQLFGSNDA
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCCEEEECCCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	17.1206	9.6375	35.1639	165
cluster_2.pdb ( medoid)	16.9777	10.4254	44.6867	177
cluster_3.pdb ( medoid)	15.11	9.53012	32.399	144
cluster_4.pdb ( medoid)	15.0637	9.09472	31.2378	137
cluster_5.pdb ( medoid)	11.3703	6.85999	31.5268	78
cluster_6.pdb ( medoid)	9.78723	5.00653	25.1371	49
cluster_7.pdb ( medoid)	8.66694	3.92295	12.03	34
cluster_8.pdb ( medoid)	5.18397	16.9754	45.9162	88
cluster_9.pdb ( medoid)	4.04847	17.0435	40.4354	69
cluster_10.pdb ( medoid)	3.66062	16.1175	46.0726	59