CABS-dock: 66ef9386c3e2a09

Project name: 66ef9386c3e2a09

Status: done

submitted: 2026-04-10 07:46:39, status changed: 2026-04-10 11:15:34

Project settings

Protein sequence(s)	APYGARMPFGGQVPLGAPPPFPTWPGCPQPPPLHAWQAGTPPPPSPQPAAFPQSLPFPQSPAFPTASPAPPQSPGLQPLIIHHAQMVQLGLNNHMWNQRGSQAPEDKTQEAE input pdb
Peptide sequence	RRRVQPYGSNDARRH
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCCCCCCCCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	17.7701	6.80919	23.7942	121
cluster_2.pdb ( medoid)	16.0705	4.85361	19.2098	78
cluster_3.pdb ( medoid)	15.4149	8.30363	26.7817	128
cluster_4.pdb ( medoid)	12.2713	4.31901	16.259	53
cluster_5.pdb ( medoid)	11.8142	10.0727	33.4559	119
cluster_6.pdb ( medoid)	9.2736	14.6653	28.0704	136
cluster_7.pdb ( medoid)	8.5921	12.6861	25.91	109
cluster_8.pdb ( medoid)	6.00249	16.8264	33.2624	101
cluster_9.pdb ( medoid)	5.84596	13.0004	25.2311	76
cluster_10.pdb ( medoid)	5.70912	13.8375	33.011	79