Project name: 67e309ce60c76d3

Status: done

submitted: 2026-07-23 05:47:28, status changed: 2026-07-23 10:20:45

Project settings
Protein sequence(s) LYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKK input pdb
Peptide sequence IGASWPDHATT
Simulation mc cycles50
Peptide secondary structure psipred CCCCCCCCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 23.3282 5.65839 28.6278 132
cluster_2.pdb ( medoid) 21.5198 7.52794 30.4341 162
cluster_3.pdb ( medoid) 18.8601 10.4454 31.1526 197
cluster_4.pdb ( medoid) 10.52 8.36504 28.1724 88
cluster_5.pdb ( medoid) 9.51775 10.7168 22.6672 102
cluster_6.pdb ( medoid) 7.93491 9.57793 20.8782 76
cluster_7.pdb ( medoid) 6.90875 9.26361 25.2422 64
cluster_8.pdb ( medoid) 4.34385 17.9564 37.7773 78
cluster_9.pdb ( medoid) 3.58888 12.5387 30.1486 45
cluster_10.pdb ( medoid) 3.23944 17.2869 34.1595 56