CABS-dock: 693a8fa9e101b61

Project name: 693a8fa9e101b61

Status: done

submitted: 2026-03-12 08:36:55, status changed: 2026-03-12 12:09:53

Project settings

Protein sequence(s)	APYGARMPFGGQVPLGAPPPFPTWPGCPQPPPLHAWQAGTPPPPSPQPAAFPQSLPFPQSPAFPTASPAPPQSPGLQPLIIHHAQMVQLGLNNHMWNQRGSQAPEDKTQEAE input pdb
Peptide sequence	KWRKGSVQLFGSNDA
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCCCEEECCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	21.7457	5.51834	27.0797	120
cluster_2.pdb ( medoid)	18.127	10.8126	44.7141	196
cluster_3.pdb ( medoid)	15.3395	7.56219	40.5822	116
cluster_4.pdb ( medoid)	8.6343	10.1919	29.4253	88
cluster_5.pdb ( medoid)	7.15546	13.4163	34.3015	96
cluster_6.pdb ( medoid)	7.10634	15.4791	35.2908	110
cluster_7.pdb ( medoid)	7.02197	11.9625	37.4079	84
cluster_8.pdb ( medoid)	6.43084	10.8851	29.4404	70
cluster_9.pdb ( medoid)	6.19202	11.4664	38.0017	71
cluster_10.pdb ( medoid)	3.34527	14.6475	30.4049	49