Project name: 69ee39de9a2fb16

Status: done

submitted: 2026-06-24 02:59:33, status changed: 2026-06-24 06:50:14

Project settings
Protein sequence(s) CIKYLLFVFNFVFWLAGGVILGVALWLRHDPQTTNLLYLELGDKPAPNTFYVGIYILIAVGAVMMFVGFLGCYGAIQESQCLLGTFFTCLVILFACEVAAGIWGFVNKDQIAKDVKQFYDQALQQAVVDDDANNAKAVVKTFHETLDCCGSSTLTALTTSVLTSNLCPSGSNIISNLFKEDCHQKIDDLFSGKLYLIGIAAIVVAVIMIFEMILSMVL input pdb
Peptide sequence RGLVSQLQIQQ
Simulation mc cycles50
Peptide secondary structure psipred CCCCCCCCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 28.3525 6.34865 28.0953 180
cluster_2.pdb ( medoid) 27.226 5.2156 33.0781 142
cluster_3.pdb ( medoid) 26.0478 3.91588 16.581 102
cluster_4.pdb ( medoid) 16.7293 5.79822 20.815 97
cluster_5.pdb ( medoid) 14.142 9.54601 24.3162 135
cluster_6.pdb ( medoid) 13.9533 9.10177 30.8917 127
cluster_7.pdb ( medoid) 10.3686 6.07601 19.9952 63
cluster_8.pdb ( medoid) 9.04091 8.18501 24.7129 74
cluster_9.pdb ( medoid) 6.63075 8.4455 17.0708 56
cluster_10.pdb ( medoid) 1.22386 19.6101 34.2721 24