CABS-dock: 6a801fa029c46eb

Project name: 6a801fa029c46eb

Status: done

submitted: 2026-01-12 06:02:25, status changed: 2026-01-12 11:19:17

Project settings

Protein sequence(s)	MLILKGTKTVDLSKDELTEIIGQFDRVHIDLGTGDGRNIYKLAINDQNTFYIGIDPVKENLFDISKKIIKKPSKGGLSSNVVFVIAAAESSLPFELKNIADSIISILFPWGTLLEYVIKPNRRDILSSNVADLAKKEAHFEFVTTYSDSYEEAEIKKRGLPLLSKAYFLSEQYKAELSNSGFRRIDDVKELDNEYVKQFNSLWAKRLAFGRKRSFFRVSGHVSKH input pdb
Peptide sequence	KENLFDISKKII
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCHHHCHHCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	32.5551	1.9659	10.5282	64
cluster_2.pdb ( medoid)	23.1209	5.92539	11.0321	137
cluster_3.pdb ( medoid)	18.7636	9.37987	37.0616	176
cluster_4.pdb ( medoid)	15.8738	3.33883	10.018	53
cluster_5.pdb ( medoid)	14.8485	10.6408	35.6709	158
cluster_6.pdb ( medoid)	14.4327	6.513	17.386	94
cluster_7.pdb ( medoid)	14.0606	8.67673	20.8613	122
cluster_8.pdb ( medoid)	13.0876	6.95313	17.5517	91
cluster_9.pdb ( medoid)	8.02843	5.97875	14.3891	48
cluster_10.pdb ( medoid)	6.21639	9.16931	17.2723	57