Project name: 7T5M_HRDSVD_E2

Status: done

submitted: 2026-05-30 16:11:46, status changed: 2026-05-31 15:24:19

Project settings
Protein sequence(s) GSSHSSMMRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRRFDSDAASQRMEEPRAPWIEQEGPPEYWDGETRRKVKAHSQTHRVDLGTLLRGYYNQSEAGSHTVQRMYGCDVVGSDWRFLRGYHQYAYDGKDYIALKEDLRSWTAADMAAQTTKHHHKWEAAHVAEQLRAYLEGTCVEWLRRYLENGKKETLQRTTDAPKKTHMMTHHAVSDHEATLRCWALSFYPPAEITLTWQRDGEDDQTQDTELVETRPAGDGTFQKWAAVVVPSSSGQEQRYTCHVQHEGLPKPLTLRWEP input pdb
Peptide sequence HRDSVDSAPILTAFNSSHKGRI
Simulation mc cycles200
Peptide secondary structure psipred CCCCCCCCCCHHHCCCCCCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 39.2974 4.58046 14.2332 180
cluster_2.pdb ( medoid) 25.0947 4.50294 10.3426 113
cluster_3.pdb ( medoid) 22.8001 5.26314 24.637 120
cluster_4.pdb ( medoid) 22.5519 5.09934 17.1629 115
cluster_5.pdb ( medoid) 21.6929 5.53177 15.5552 120
cluster_6.pdb ( medoid) 10.7129 10.6413 20.9885 114
cluster_7.pdb ( medoid) 7.87489 12.1907 25.643 96
cluster_8.pdb ( medoid) 7.2774 8.51953 17.735 62
cluster_9.pdb ( medoid) 6.81311 6.16459 20.5371 42
cluster_10.pdb ( medoid) 6.78229 5.60283 13.4307 38