CABS-dock: 6d4ed4ce4ab6d8b

Project name: 6d4ed4ce4ab6d8b

Status: done

submitted: 2026-02-19 16:20:35, status changed: 2026-02-19 20:55:48

Project settings

Protein sequence(s)	DWVIPPISCPENEKGPFPKNLVQIKSNKDKEGKVFYSITGQGADTPPVGVFIIERETGWLKVTEPLDRERIATYTLFSHAVSSNGNAVEDPMEILITVTDQNDNKPEFTQEVFKGSVMEGALPGTSVMEVTATDADDDVNTYNAAIAYTILSQDPELPDKNMFTINRNTGVISVVTTGLDRESFPTYTLVVQAADLQGEGLSTTATAVITVTDTNDNPPIF input pdb
Peptide sequence	DWVIPP
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	39.566	3.4373	28.5403	136
cluster_2.pdb ( medoid)	29.7352	5.9189	17.3235	176
cluster_3.pdb ( medoid)	23.073	4.72414	37.573	109
cluster_4.pdb ( medoid)	20.6213	5.86772	17.0992	121
cluster_5.pdb ( medoid)	19.5697	5.00774	23.2566	98
cluster_6.pdb ( medoid)	17.9976	6.94538	17.6511	125
cluster_7.pdb ( medoid)	10.9592	8.94223	29.4023	98
cluster_8.pdb ( medoid)	7.99345	9.00738	23.6233	72
cluster_9.pdb ( medoid)	7.26363	6.88361	29.2195	50
cluster_10.pdb ( medoid)	1.66309	9.01933	20.3435	15