CABS-dock: CRVTARR03

Project name: CRVTARR03

Status: done

submitted: 2026-07-15 03:34:16, status changed: 2026-07-15 05:36:27

Project settings

Protein sequence(s)	AFTVTVPKDLYVVEYGSNMTIECKFPVEKQLDLAALIVYWEMEDKNIIQFVHGEEDLKVQHSSYRQRARLLKDQLSLGNAALQITDVKLQDAGVYRCMISYGGADYKRITVKVNA input pdb
Peptide sequence	CRVTARR
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	34.7548	5.6395	38.1004	196
cluster_2.pdb ( medoid)	30.2484	6.2152	25.3592	188
cluster_3.pdb ( medoid)	19.0748	6.08133	24.2002	116
cluster_4.pdb ( medoid)	16.1087	5.58704	19.2768	90
cluster_5.pdb ( medoid)	14.0852	9.30056	34.5196	131
cluster_6.pdb ( medoid)	8.81464	8.96236	27.8904	79
cluster_7.pdb ( medoid)	7.91345	6.69746	16.3763	53
cluster_8.pdb ( medoid)	6.51075	8.60116	19.5006	56
cluster_9.pdb ( medoid)	3.29538	14.5659	36.5346	48
cluster_10.pdb ( medoid)	3.15073	13.6476	33.3268	43