Project name: CRVTARR03

Status: done

submitted: 2026-07-15 03:34:16, status changed: 2026-07-15 05:36:27

Project settings
Protein sequence(s) AFTVTVPKDLYVVEYGSNMTIECKFPVEKQLDLAALIVYWEMEDKNIIQFVHGEEDLKVQHSSYRQRARLLKDQLSLGNAALQITDVKLQDAGVYRCMISYGGADYKRITVKVNA input pdb
Peptide sequence CRVTARR
Simulation mc cycles50
Peptide secondary structure psipred CCCCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 34.7548 5.6395 38.1004 196
cluster_2.pdb ( medoid) 30.2484 6.2152 25.3592 188
cluster_3.pdb ( medoid) 19.0748 6.08133 24.2002 116
cluster_4.pdb ( medoid) 16.1087 5.58704 19.2768 90
cluster_5.pdb ( medoid) 14.0852 9.30056 34.5196 131
cluster_6.pdb ( medoid) 8.81464 8.96236 27.8904 79
cluster_7.pdb ( medoid) 7.91345 6.69746 16.3763 53
cluster_8.pdb ( medoid) 6.51075 8.60116 19.5006 56
cluster_9.pdb ( medoid) 3.29538 14.5659 36.5346 48
cluster_10.pdb ( medoid) 3.15073 13.6476 33.3268 43