Project name: 9ASF_HRDSVD_E2

Status: done

submitted: 2026-05-30 16:27:05, status changed: 2026-05-31 10:19:38

Project settings
Protein sequence(s) GSSHSMRYFFTSVSRPGRGEPRFIAVVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDQETRNVKAQSSQQTDRVDLGTLRGYYNQSEAGSHTIQIMYGCDVGSDGRFLRGYRQDAYDGKDYIALNEDLRSWTAADMAAQITKRKWEAAHEAEQLRAYLDGTCVEWLRRYLENGKETLQRTDPPKTHMTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRW input pdb
Peptide sequence HRDSVDSAPILTAFNSSHKGRI
Simulation mc cycles200
Peptide secondary structure psipred CCCCCCCCCCHHHCCCCCCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 42.1303 5.03201 64.6865 212
cluster_2.pdb ( medoid) 21.1992 5.80212 34.8419 123
cluster_3.pdb ( medoid) 11.3028 11.3246 53.6242 128
cluster_4.pdb ( medoid) 9.46269 9.7224 23.5532 92
cluster_5.pdb ( medoid) 8.74992 15.7716 66.6303 138
cluster_6.pdb ( medoid) 7.9703 11.9193 44.2102 95
cluster_7.pdb ( medoid) 7.22095 8.17067 20.9621 59
cluster_8.pdb ( medoid) 5.27617 14.7834 44.4894 78
cluster_9.pdb ( medoid) 2.57364 10.8795 23.7058 28
cluster_10.pdb ( medoid) 1.63582 27.5091 50.6258 45