CABS-dock: 9ASF_HRDSVD

Project name: 9ASF_HRDSVD_E2

Status: done

submitted: 2026-05-30 16:27:05, status changed: 2026-05-31 10:19:38

Project settings

Protein sequence(s)	GSSHSMRYFFTSVSRPGRGEPRFIAVVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDQETRNVKAQSSQQTDRVDLGTLRGYYNQSEAGSHTIQIMYGCDVGSDGRFLRGYRQDAYDGKDYIALNEDLRSWTAADMAAQITKRKWEAAHEAEQLRAYLDGTCVEWLRRYLENGKETLQRTDPPKTHMTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRW input pdb
Peptide sequence	HRDSVDSAPILTAFNSSHKGRI
Simulation mc cycles	200
Peptide secondary structure psipred	CCCCCCCCCCHHHCCCCCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	42.1303	5.03201	64.6865	212
cluster_2.pdb ( medoid)	21.1992	5.80212	34.8419	123
cluster_3.pdb ( medoid)	11.3028	11.3246	53.6242	128
cluster_4.pdb ( medoid)	9.46269	9.7224	23.5532	92
cluster_5.pdb ( medoid)	8.74992	15.7716	66.6303	138
cluster_6.pdb ( medoid)	7.9703	11.9193	44.2102	95
cluster_7.pdb ( medoid)	7.22095	8.17067	20.9621	59
cluster_8.pdb ( medoid)	5.27617	14.7834	44.4894	78
cluster_9.pdb ( medoid)	2.57364	10.8795	23.7058	28
cluster_10.pdb ( medoid)	1.63582	27.5091	50.6258	45