CABS-dock: SYTNSQYNSS-YW

Project name: SYTNSQYNSS-YW

Status: done

submitted: 2026-07-23 08:48:10, status changed: 2026-07-23 12:52:04

Project settings

Protein sequence(s)	GTFLAYAQFNDTEVPLIEYSFYSDESLQYPKTVRVPYPKAGAVNPTVKFFVVNTDSLSSVTNATSIQITAPASMLIGDHYLCDVTWATQERISLQWLRRIQNYSVMDICDYDESSGRWNCLVARQHIEMSTTGWVGRFRPS input pdb
Peptide sequence	SYTNSQYNSS
Simulation mc cycles	100
Peptide secondary structure psipred	CCCCCCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	52.7274	1.97241	10.3128	104
cluster_2.pdb ( medoid)	24.9349	6.57713	27.5509	164
cluster_3.pdb ( medoid)	18.9594	5.74913	21.3398	109
cluster_4.pdb ( medoid)	16.6184	10.5305	38.1968	175
cluster_5.pdb ( medoid)	13.5362	5.09745	10.6304	69
cluster_6.pdb ( medoid)	12.3408	10.4532	33.5981	129
cluster_7.pdb ( medoid)	8.14436	8.34934	27.0674	68
cluster_8.pdb ( medoid)	6.47114	10.1991	37.3216	66
cluster_9.pdb ( medoid)	4.62286	16.8727	33.1005	78
cluster_10.pdb ( medoid)	3.31298	11.47	28.9994	38