Project name: SYTNSQYNSS-YW

Status: done

submitted: 2026-07-23 08:48:10, status changed: 2026-07-23 12:52:04

Project settings
Protein sequence(s) GTFLAYAQFNDTEVPLIEYSFYSDESLQYPKTVRVPYPKAGAVNPTVKFFVVNTDSLSSVTNATSIQITAPASMLIGDHYLCDVTWATQERISLQWLRRIQNYSVMDICDYDESSGRWNCLVARQHIEMSTTGWVGRFRPS input pdb
Peptide sequence SYTNSQYNSS
Simulation mc cycles100
Peptide secondary structure psipred CCCCCCCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 52.7274 1.97241 10.3128 104
cluster_2.pdb ( medoid) 24.9349 6.57713 27.5509 164
cluster_3.pdb ( medoid) 18.9594 5.74913 21.3398 109
cluster_4.pdb ( medoid) 16.6184 10.5305 38.1968 175
cluster_5.pdb ( medoid) 13.5362 5.09745 10.6304 69
cluster_6.pdb ( medoid) 12.3408 10.4532 33.5981 129
cluster_7.pdb ( medoid) 8.14436 8.34934 27.0674 68
cluster_8.pdb ( medoid) 6.47114 10.1991 37.3216 66
cluster_9.pdb ( medoid) 4.62286 16.8727 33.1005 78
cluster_10.pdb ( medoid) 3.31298 11.47 28.9994 38