CABS-dock: 7T5M_EMGFKH

Project name: 7T5M_EMGFKH_E2

Status: done

submitted: 2026-05-30 16:08:36, status changed: 2026-05-31 15:29:44

Project settings

Protein sequence(s)	GSSHSSMMRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRRFDSDAASQRMEEPRAPWIEQEGPPEYWDGETRRKVKAHSQTHRVDLGTLLRGYYNQSEAGSHTVQRMYGCDVVGSDWRFLRGYHQYAYDGKDYIALKEDLRSWTAADMAAQTTKHHHKWEAAHVAEQLRAYLEGTCVEWLRRYLENGKKETLQRTTDAPKKTHMMTHHAVSDHEATLRCWALSFYPPAEITLTWQRDGEDDQTQDTELVETRPAGDGTFQKWAAVVVPSSSGQEQRYTCHVQHEGLPKPLTLRWEP input pdb
Peptide sequence	EMGFKHINHQVVPTLAVSKNKAL
Simulation mc cycles	200
Peptide secondary structure psipred	CCCCCCCCCCCCCEEEEECCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	46.0735	4.60134	24.627	212
cluster_2.pdb ( medoid)	23.2581	5.33147	19.3217	124
cluster_3.pdb ( medoid)	18.3096	3.76851	15.353	69
cluster_4.pdb ( medoid)	14.8349	6.80828	17.8778	101
cluster_5.pdb ( medoid)	12.6821	5.44075	13.8613	69
cluster_6.pdb ( medoid)	9.63549	8.82155	16.7868	85
cluster_7.pdb ( medoid)	9.48912	6.95533	12.998	66
cluster_8.pdb ( medoid)	7.29986	10.0002	29.5864	73
cluster_9.pdb ( medoid)	6.11237	10.4706	32.0268	64
cluster_10.pdb ( medoid)	3.45902	11.2749	30.7516	39