Project name: 7T5M_EMGFKH_E2

Status: done

submitted: 2026-05-30 16:08:36, status changed: 2026-05-31 15:29:44

Project settings
Protein sequence(s) GSSHSSMMRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRRFDSDAASQRMEEPRAPWIEQEGPPEYWDGETRRKVKAHSQTHRVDLGTLLRGYYNQSEAGSHTVQRMYGCDVVGSDWRFLRGYHQYAYDGKDYIALKEDLRSWTAADMAAQTTKHHHKWEAAHVAEQLRAYLEGTCVEWLRRYLENGKKETLQRTTDAPKKTHMMTHHAVSDHEATLRCWALSFYPPAEITLTWQRDGEDDQTQDTELVETRPAGDGTFQKWAAVVVPSSSGQEQRYTCHVQHEGLPKPLTLRWEP input pdb
Peptide sequence EMGFKHINHQVVPTLAVSKNKAL
Simulation mc cycles200
Peptide secondary structure psipred CCCCCCCCCCCCCEEEEECCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 46.0735 4.60134 24.627 212
cluster_2.pdb ( medoid) 23.2581 5.33147 19.3217 124
cluster_3.pdb ( medoid) 18.3096 3.76851 15.353 69
cluster_4.pdb ( medoid) 14.8349 6.80828 17.8778 101
cluster_5.pdb ( medoid) 12.6821 5.44075 13.8613 69
cluster_6.pdb ( medoid) 9.63549 8.82155 16.7868 85
cluster_7.pdb ( medoid) 9.48912 6.95533 12.998 66
cluster_8.pdb ( medoid) 7.29986 10.0002 29.5864 73
cluster_9.pdb ( medoid) 6.11237 10.4706 32.0268 64
cluster_10.pdb ( medoid) 3.45902 11.2749 30.7516 39