CABS-dock: 7NUI_ANHPAA

Project name: 7NUI_ANHPAA_E2

Status: done

submitted: 2026-05-30 16:02:55, status changed: 2026-05-31 15:03:12

Project settings

Protein sequence(s)	GSHSMRYFDTAMSRPGRGEPRFISSVGYVDDTQFVRFDSDAASPRMEPRAPWIEQEGPEYWDRNTQIFKTNTQTDRESLRNLRGYYNQSEAGSHTLQSMYGCDVGPDGRLLRGHNQYAYDGKDYIALNEDLRSWTAADTAAQITQRKWEAARVAEQDRAYLEGTCVEWLRRYLENGKDTLERADPPKTHVTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWEP input pdb
Peptide sequence	ANHPAATHTKAVALGTEE
Simulation mc cycles	200
Peptide secondary structure psipred	CCCCCCCCCCCHHCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	39.7321	5.26023	12.2164	209
cluster_2.pdb ( medoid)	31.8282	4.30436	13.2516	137
cluster_3.pdb ( medoid)	17.8411	3.30697	25.6675	59
cluster_4.pdb ( medoid)	13.5516	3.54202	8.89068	48
cluster_5.pdb ( medoid)	10.5317	5.12736	11.4299	54
cluster_6.pdb ( medoid)	9.80538	6.22108	31.7242	61
cluster_7.pdb ( medoid)	6.44613	5.11935	29.129	33
cluster_8.pdb ( medoid)	6.37892	12.071	34.6319	77
cluster_9.pdb ( medoid)	5.45071	15.5943	57.116	85
cluster_10.pdb ( medoid)	5.05591	11.2739	21.0393	57