Project name: 7NUI_ANHPAA_E2

Status: done

submitted: 2026-05-30 16:02:55, status changed: 2026-05-31 15:03:12

Project settings
Protein sequence(s) GSHSMRYFDTAMSRPGRGEPRFISSVGYVDDTQFVRFDSDAASPRMEPRAPWIEQEGPEYWDRNTQIFKTNTQTDRESLRNLRGYYNQSEAGSHTLQSMYGCDVGPDGRLLRGHNQYAYDGKDYIALNEDLRSWTAADTAAQITQRKWEAARVAEQDRAYLEGTCVEWLRRYLENGKDTLERADPPKTHVTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWEP input pdb
Peptide sequence ANHPAATHTKAVALGTEE
Simulation mc cycles200
Peptide secondary structure psipred CCCCCCCCCCCHHCCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 39.7321 5.26023 12.2164 209
cluster_2.pdb ( medoid) 31.8282 4.30436 13.2516 137
cluster_3.pdb ( medoid) 17.8411 3.30697 25.6675 59
cluster_4.pdb ( medoid) 13.5516 3.54202 8.89068 48
cluster_5.pdb ( medoid) 10.5317 5.12736 11.4299 54
cluster_6.pdb ( medoid) 9.80538 6.22108 31.7242 61
cluster_7.pdb ( medoid) 6.44613 5.11935 29.129 33
cluster_8.pdb ( medoid) 6.37892 12.071 34.6319 77
cluster_9.pdb ( medoid) 5.45071 15.5943 57.116 85
cluster_10.pdb ( medoid) 5.05591 11.2739 21.0393 57