Project name: 760e58067174620

Status: done

submitted: 2026-06-23 17:06:40, status changed: 2026-06-23 22:32:15

Project settings
Protein sequence(s) VKDFLSQLRSSNRRFSIPESGQGGTEMDGFRRTIENQHSRNDVMVSEWLNKLNLEEPPSSVPKKCPSLTKRSRAQEEQVPQAWTAGTSSDSMAQPPQTPETSTFRNQMPSPTSTGTPSPGPRGNQGAERQGMNWSCRTPEPNPVTGRPLVNIYNCSGVQVGDNNYLTMQQTTALPTWGLAPSGKGRGLQHPPPVGSQEGPKDPEAWSRPQGWYNHSGK input pdb
Peptide sequence VQLFGYHHHHHHHHHHH
Simulation mc cycles50
Peptide secondary structure psipred CCCCCCCCCCCCCCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 37.1699 2.74415 15.7509 102
cluster_2.pdb ( medoid) 21.0467 6.08173 21.7652 128
cluster_3.pdb ( medoid) 18.6634 7.76922 28.8647 145
cluster_4.pdb ( medoid) 17.2777 7.46627 36.9833 129
cluster_5.pdb ( medoid) 10.0416 12.3486 26.3803 124
cluster_6.pdb ( medoid) 6.99964 11.4292 26.8458 80
cluster_7.pdb ( medoid) 6.71375 12.2137 30.597 82
cluster_8.pdb ( medoid) 5.84765 17.2719 38.329 101
cluster_9.pdb ( medoid) 4.86243 11.9282 27.3087 58
cluster_10.pdb ( medoid) 3.7633 13.5519 35.1813 51