CABS-dock: 760e58067174620

Project name: 760e58067174620

Status: done

submitted: 2026-06-23 17:06:40, status changed: 2026-06-23 22:32:15

Project settings

Protein sequence(s)	VKDFLSQLRSSNRRFSIPESGQGGTEMDGFRRTIENQHSRNDVMVSEWLNKLNLEEPPSSVPKKCPSLTKRSRAQEEQVPQAWTAGTSSDSMAQPPQTPETSTFRNQMPSPTSTGTPSPGPRGNQGAERQGMNWSCRTPEPNPVTGRPLVNIYNCSGVQVGDNNYLTMQQTTALPTWGLAPSGKGRGLQHPPPVGSQEGPKDPEAWSRPQGWYNHSGK input pdb
Peptide sequence	VQLFGYHHHHHHHHHHH
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCCCCCCCCCCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	37.1699	2.74415	15.7509	102
cluster_2.pdb ( medoid)	21.0467	6.08173	21.7652	128
cluster_3.pdb ( medoid)	18.6634	7.76922	28.8647	145
cluster_4.pdb ( medoid)	17.2777	7.46627	36.9833	129
cluster_5.pdb ( medoid)	10.0416	12.3486	26.3803	124
cluster_6.pdb ( medoid)	6.99964	11.4292	26.8458	80
cluster_7.pdb ( medoid)	6.71375	12.2137	30.597	82
cluster_8.pdb ( medoid)	5.84765	17.2719	38.329	101
cluster_9.pdb ( medoid)	4.86243	11.9282	27.3087	58
cluster_10.pdb ( medoid)	3.7633	13.5519	35.1813	51