CABS-dock: 77df4ebd6ceee70

Project name: 77df4ebd6ceee70

Status: done

submitted: 2026-03-14 09:37:43, status changed: 2026-03-14 12:08:17

Project settings

Protein sequence(s)	NTTVFQGVAGQSLQVSCPYDSMKHWGRRKAWCRQLGEKGPCQRVVSTHNLWLLSFLRRWNGSTAITDDTLGGTLTITLRNLQPHDAGLYQCQSLHGSEADTLRKVLVEVLADPLDHRD input pdb
Peptide sequence	FFVLKGADYKRITLKVN
Simulation mc cycles	50
Peptide secondary structure psipred	CEEEECCCEEEEEEEEC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	45.748	2.25146	29.862	103
cluster_2.pdb ( medoid)	26.1971	7.55808	27.5579	198
cluster_3.pdb ( medoid)	18.7143	6.83968	25.1575	128
cluster_4.pdb ( medoid)	17.3215	9.46803	31.8763	164
cluster_5.pdb ( medoid)	11.9201	4.78185	19.9333	57
cluster_6.pdb ( medoid)	10.3308	11.9062	32.8873	123
cluster_7.pdb ( medoid)	8.40346	8.92489	24.8322	75
cluster_8.pdb ( medoid)	5.77472	11.4291	25.8445	66
cluster_9.pdb ( medoid)	5.19812	9.81124	26.775	51
cluster_10.pdb ( medoid)	3.34011	10.4787	19.9742	35