CABS-dock: 7a4b47fc432c4a9

Project name: 7a4b47fc432c4a9

Status: done

submitted: 2026-07-22 09:13:36, status changed: 2026-07-22 11:11:44

Project settings

Protein sequence(s)	APYGARMPFGGQVPLGAPPPFPTWPGCPQPPPLHAWQAGTPPPPSPQPAAFPQSLPFPQSPAFPTASPAPPQSPGLQPLIIHHAQMVQLGLNNHMWNQRGSQAPEDKTQEAE input pdb
Peptide sequence	VQCGSNCRRVIRRV
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCCCCCHHHHCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	23.9782	5.5467	25.0534	133
cluster_2.pdb ( medoid)	19.4456	2.98268	17.1555	58
cluster_3.pdb ( medoid)	14.3782	3.82522	25.4236	55
cluster_4.pdb ( medoid)	14.0942	8.51412	25.6746	120
cluster_5.pdb ( medoid)	11.5998	12.3278	36.7089	143
cluster_6.pdb ( medoid)	10.1543	8.76475	22.7025	89
cluster_7.pdb ( medoid)	10.1331	10.362	30.4139	105
cluster_8.pdb ( medoid)	9.44883	14.0758	28.1544	133
cluster_9.pdb ( medoid)	7.45075	11.8109	35.8981	88
cluster_10.pdb ( medoid)	5.35658	14.1882	31.6581	76