Project name: 7a4b47fc432c4a9

Status: done

submitted: 2026-07-22 09:13:36, status changed: 2026-07-22 11:11:44

Project settings
Protein sequence(s) APYGARMPFGGQVPLGAPPPFPTWPGCPQPPPLHAWQAGTPPPPSPQPAAFPQSLPFPQSPAFPTASPAPPQSPGLQPLIIHHAQMVQLGLNNHMWNQRGSQAPEDKTQEAE input pdb
Peptide sequence VQCGSNCRRVIRRV
Simulation mc cycles50
Peptide secondary structure psipred CCCCCCCCHHHHCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 23.9782 5.5467 25.0534 133
cluster_2.pdb ( medoid) 19.4456 2.98268 17.1555 58
cluster_3.pdb ( medoid) 14.3782 3.82522 25.4236 55
cluster_4.pdb ( medoid) 14.0942 8.51412 25.6746 120
cluster_5.pdb ( medoid) 11.5998 12.3278 36.7089 143
cluster_6.pdb ( medoid) 10.1543 8.76475 22.7025 89
cluster_7.pdb ( medoid) 10.1331 10.362 30.4139 105
cluster_8.pdb ( medoid) 9.44883 14.0758 28.1544 133
cluster_9.pdb ( medoid) 7.45075 11.8109 35.8981 88
cluster_10.pdb ( medoid) 5.35658 14.1882 31.6581 76