Project name: CRVTARR02

Status: done

submitted: 2026-07-15 03:33:16, status changed: 2026-07-15 05:34:31

Project settings
Protein sequence(s) AFTVTVPKDLYVVEYGSNMTIECKFPVEKQLDLAALIVYWEMEDKNIIQFVHGEEDLKVQHSSYRQRARLLKDQLSLGNAALQITDVKLQDAGVYRCMISYGGADYKRITVKVNA input pdb
Peptide sequence CRVTARR
Simulation mc cycles50
Peptide secondary structure psipred CCCCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 52.2451 3.67499 23.4651 192
cluster_2.pdb ( medoid) 49.4921 2.3034 8.12865 114
cluster_3.pdb ( medoid) 40.1411 4.1105 13.6058 165
cluster_4.pdb ( medoid) 38.405 3.28083 11.0736 126
cluster_5.pdb ( medoid) 25.6877 4.32114 26.2564 111
cluster_6.pdb ( medoid) 12.7769 5.24385 10.584 67
cluster_7.pdb ( medoid) 12.5425 3.98646 7.74123 50
cluster_8.pdb ( medoid) 10.7652 5.75932 13.7931 62
cluster_9.pdb ( medoid) 7.48962 8.41164 20.2661 63
cluster_10.pdb ( medoid) 4.63544 10.7865 28.8709 50