CABS-dock: 804ae623a26f9ef

Project name: 804ae623a26f9ef

Status: done

submitted: 2026-07-22 09:13:08, status changed: 2026-07-22 12:18:23

Project settings

Protein sequence(s)	EGVLYVGSKTKEGVVHDVTTVAQKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLEGVLYVGSKTKEGVVHDVTTVAQKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLEGVLYVGSKTKEGVVHDVTTVAQKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQL input pdb
Peptide sequence	TTDHISAAGPW
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCCCCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	26.7104	6.25226	21.8142	167
cluster_2.pdb ( medoid)	24.1685	5.87541	22.5268	142
cluster_3.pdb ( medoid)	20.7259	5.59685	35.3425	116
cluster_4.pdb ( medoid)	16.3843	6.95787	19.5419	114
cluster_5.pdb ( medoid)	13.0283	5.60319	16.1188	73
cluster_6.pdb ( medoid)	8.39135	6.91188	16.588	58
cluster_7.pdb ( medoid)	7.85434	15.5328	44.0238	122
cluster_8.pdb ( medoid)	6.3724	16.6342	39.9509	106
cluster_9.pdb ( medoid)	5.09933	12.1585	32.2575	62
cluster_10.pdb ( medoid)	4.38345	9.12524	20.357	40