Project name: 804ae623a26f9ef

Status: done

submitted: 2026-07-22 09:13:08, status changed: 2026-07-22 12:18:23

Project settings
Protein sequence(s) EGVLYVGSKTKEGVVHDVTTVAQKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLEGVLYVGSKTKEGVVHDVTTVAQKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLEGVLYVGSKTKEGVVHDVTTVAQKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQL input pdb
Peptide sequence TTDHISAAGPW
Simulation mc cycles50
Peptide secondary structure psipred CCCCCCCCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 26.7104 6.25226 21.8142 167
cluster_2.pdb ( medoid) 24.1685 5.87541 22.5268 142
cluster_3.pdb ( medoid) 20.7259 5.59685 35.3425 116
cluster_4.pdb ( medoid) 16.3843 6.95787 19.5419 114
cluster_5.pdb ( medoid) 13.0283 5.60319 16.1188 73
cluster_6.pdb ( medoid) 8.39135 6.91188 16.588 58
cluster_7.pdb ( medoid) 7.85434 15.5328 44.0238 122
cluster_8.pdb ( medoid) 6.3724 16.6342 39.9509 106
cluster_9.pdb ( medoid) 5.09933 12.1585 32.2575 62
cluster_10.pdb ( medoid) 4.38345 9.12524 20.357 40