CABS-dock: 7T5M_CEEASV

Project name: 7T5M_CEEASV_E2

Status: done

submitted: 2026-05-30 16:10:30, status changed: 2026-05-31 15:35:20

Project settings

Protein sequence(s)	GSSHSSMMRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRRFDSDAASQRMEEPRAPWIEQEGPPEYWDGETRRKVKAHSQTHRVDLGTLLRGYYNQSEAGSHTVQRMYGCDVVGSDWRFLRGYHQYAYDGKDYIALKEDLRSWTAADMAAQTTKHHHKWEAAHVAEQLRAYLEGTCVEWLRRYLENGKKETLQRTTDAPKKTHMMTHHAVSDHEATLRCWALSFYPPAEITLTWQRDGEDDQTQDTELVETRPAGDGTFQKWAAVVVPSSSGQEQRYTCHVQHEGLPKPLTLRWEP input pdb
Peptide sequence	CEEASVTVVEGQVDYYGLYYVHEGIR
Simulation mc cycles	200
Peptide secondary structure psipred	CCCCEEEEEEEEEEEEEEEEEECCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	39.2618	5.65436	40.6027	222
cluster_2.pdb ( medoid)	20.2807	6.50864	30.6033	132
cluster_3.pdb ( medoid)	12.6474	4.665	27.547	59
cluster_4.pdb ( medoid)	11.3542	5.19631	28.3891	59
cluster_5.pdb ( medoid)	10.8368	10.7042	32.1649	116
cluster_6.pdb ( medoid)	9.54895	12.4621	39.3685	119
cluster_7.pdb ( medoid)	5.58522	15.3978	36.4109	86
cluster_8.pdb ( medoid)	5.23029	12.6188	34.4998	66
cluster_9.pdb ( medoid)	2.6828	15.2825	39.8785	41
cluster_10.pdb ( medoid)	2.30673	11.2713	23.2831	26