Project name: 7T5M_CEEASV_E2

Status: done

submitted: 2026-05-30 16:10:30, status changed: 2026-05-31 15:35:20

Project settings
Protein sequence(s) GSSHSSMMRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRRFDSDAASQRMEEPRAPWIEQEGPPEYWDGETRRKVKAHSQTHRVDLGTLLRGYYNQSEAGSHTVQRMYGCDVVGSDWRFLRGYHQYAYDGKDYIALKEDLRSWTAADMAAQTTKHHHKWEAAHVAEQLRAYLEGTCVEWLRRYLENGKKETLQRTTDAPKKTHMMTHHAVSDHEATLRCWALSFYPPAEITLTWQRDGEDDQTQDTELVETRPAGDGTFQKWAAVVVPSSSGQEQRYTCHVQHEGLPKPLTLRWEP input pdb
Peptide sequence CEEASVTVVEGQVDYYGLYYVHEGIR
Simulation mc cycles200
Peptide secondary structure psipred CCCCEEEEEEEEEEEEEEEEEECCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 39.2618 5.65436 40.6027 222
cluster_2.pdb ( medoid) 20.2807 6.50864 30.6033 132
cluster_3.pdb ( medoid) 12.6474 4.665 27.547 59
cluster_4.pdb ( medoid) 11.3542 5.19631 28.3891 59
cluster_5.pdb ( medoid) 10.8368 10.7042 32.1649 116
cluster_6.pdb ( medoid) 9.54895 12.4621 39.3685 119
cluster_7.pdb ( medoid) 5.58522 15.3978 36.4109 86
cluster_8.pdb ( medoid) 5.23029 12.6188 34.4998 66
cluster_9.pdb ( medoid) 2.6828 15.2825 39.8785 41
cluster_10.pdb ( medoid) 2.30673 11.2713 23.2831 26