CABS-dock: PEP2

Project name: PEP2

Status: done

submitted: 2026-04-09 09:08:44, status changed: 2026-04-09 12:37:18

Project settings

Protein sequence(s)	GKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQL input pdb
Peptide sequence	VSEGKEKKGRLR
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCCCCCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	38.4561	4.47263	19.7676	172
cluster_2.pdb ( medoid)	38.326	2.71356	35.2716	104
cluster_3.pdb ( medoid)	24.5988	4.67503	31.9854	115
cluster_4.pdb ( medoid)	12.2196	14.4031	49.1631	176
cluster_5.pdb ( medoid)	11.2425	8.09431	28.0319	91
cluster_6.pdb ( medoid)	10.2729	6.81401	21.2946	70
cluster_7.pdb ( medoid)	9.413	9.87996	23.8696	93
cluster_8.pdb ( medoid)	6.59255	13.3484	42.1161	88
cluster_9.pdb ( medoid)	6.11974	9.31412	26.4648	57
cluster_10.pdb ( medoid)	5.70256	5.96223	10.1541	34