CABS-dock: CREB5_350_430_cJun_26_55

Project name: CREB5_350_430_cJun_26_55_run1

Status: done

submitted: 2026-07-16 06:04:59, status changed: 2026-07-16 08:26:08

Project settings

Protein sequence(s)	MQPTQTIQPPQPTGGRRRKVVDEDPDERRRKFLERNRAAATRCRQKRKVWVMSLEKKAEELTQTNMQLQNEVSMLKNEVAQ input pdb
Peptide sequence	PKILKQSMTLNLADPVGSLKPHLRAKNSDL
Simulation mc cycles	100
Peptide secondary structure psipred	CCCCCCCCEEEECCCCCCCCHHHHHHCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	19.3607	6.09482	33.6956	118
cluster_2.pdb ( medoid)	15.8967	10.1279	26.4431	161
cluster_3.pdb ( medoid)	11.3064	11.6748	27.6938	132
cluster_4.pdb ( medoid)	10.6811	11.422	25.8938	122
cluster_5.pdb ( medoid)	8.44838	7.57542	24.4929	64
cluster_6.pdb ( medoid)	8.33839	16.0702	39.3095	134
cluster_7.pdb ( medoid)	6.83417	14.1934	31.3278	97
cluster_8.pdb ( medoid)	4.34143	11.9776	25.6442	52
cluster_9.pdb ( medoid)	3.72479	23.357	47.319	87
cluster_10.pdb ( medoid)	2.39005	13.8073	25.6811	33