Project name: CREB5_350_430_cJun_26_55_run1

Status: done

submitted: 2026-07-16 06:04:59, status changed: 2026-07-16 08:26:08

Project settings
Protein sequence(s) MQPTQTIQPPQPTGGRRRKVVDEDPDERRRKFLERNRAAATRCRQKRKVWVMSLEKKAEELTQTNMQLQNEVSMLKNEVAQ input pdb
Peptide sequence PKILKQSMTLNLADPVGSLKPHLRAKNSDL
Simulation mc cycles100
Peptide secondary structure psipred CCCCCCCCEEEECCCCCCCCHHHHHHCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 19.3607 6.09482 33.6956 118
cluster_2.pdb ( medoid) 15.8967 10.1279 26.4431 161
cluster_3.pdb ( medoid) 11.3064 11.6748 27.6938 132
cluster_4.pdb ( medoid) 10.6811 11.422 25.8938 122
cluster_5.pdb ( medoid) 8.44838 7.57542 24.4929 64
cluster_6.pdb ( medoid) 8.33839 16.0702 39.3095 134
cluster_7.pdb ( medoid) 6.83417 14.1934 31.3278 97
cluster_8.pdb ( medoid) 4.34143 11.9776 25.6442 52
cluster_9.pdb ( medoid) 3.72479 23.357 47.319 87
cluster_10.pdb ( medoid) 2.39005 13.8073 25.6811 33