CABS-dock: 2YAD-R2(50-65)

Project name: 2YAD-R2(50-65)

Status: done

submitted: 2026-05-03 15:46:29, status changed: 2026-05-03 20:39:49

Project settings

Protein sequence(s)	TTATFSIGSTGLVVYDYQQLLIAYKPAPGTCCYIMKIAPESIPSLEALTRKVHNFQMECSLGMAVSTLCGEVPLYYIVTTATFSIGSTGLVVYDYQQLLIAYKPAPGTCCYIMKIAPESIPSLEALTRKVHNFQMECSFLGMAVSTLCGEVPLYYIVTTATFSIGSTGLVVYDYQQLLIAYKPAPGTCCYIMKIAPESIPSLEALTRKVHNFQMECFLGMAVSTLCGEVPLYYI input pdb
Peptide sequence	YGQSSYSSYGQSQNTG
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCCCCCCCCCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	19.6834	5.63927	34.7103	111
cluster_2.pdb ( medoid)	15.0788	7.62662	48.1324	115
cluster_3.pdb ( medoid)	14.4005	9.65246	34.1242	139
cluster_4.pdb ( medoid)	13.2421	8.4579	26.1479	112
cluster_5.pdb ( medoid)	11.5473	8.74666	38.8083	101
cluster_6.pdb ( medoid)	9.91136	10.2912	29.8833	102
cluster_7.pdb ( medoid)	6.41569	12.0018	38.2806	77
cluster_8.pdb ( medoid)	6.15509	14.7845	39.6878	91
cluster_9.pdb ( medoid)	6.04332	13.2378	33.5717	80
cluster_10.pdb ( medoid)	5.70405	12.6226	43.3672	72