Project name: 2YAD-R2(50-65)

Status: done

submitted: 2026-05-03 15:46:29, status changed: 2026-05-03 20:39:49

Project settings
Protein sequence(s) TTATFSIGSTGLVVYDYQQLLIAYKPAPGTCCYIMKIAPESIPSLEALTRKVHNFQMECSLGMAVSTLCGEVPLYYIVTTATFSIGSTGLVVYDYQQLLIAYKPAPGTCCYIMKIAPESIPSLEALTRKVHNFQMECSFLGMAVSTLCGEVPLYYIVTTATFSIGSTGLVVYDYQQLLIAYKPAPGTCCYIMKIAPESIPSLEALTRKVHNFQMECFLGMAVSTLCGEVPLYYI input pdb
Peptide sequence YGQSSYSSYGQSQNTG
Simulation mc cycles50
Peptide secondary structure psipred CCCCCCCCCCCCCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 19.6834 5.63927 34.7103 111
cluster_2.pdb ( medoid) 15.0788 7.62662 48.1324 115
cluster_3.pdb ( medoid) 14.4005 9.65246 34.1242 139
cluster_4.pdb ( medoid) 13.2421 8.4579 26.1479 112
cluster_5.pdb ( medoid) 11.5473 8.74666 38.8083 101
cluster_6.pdb ( medoid) 9.91136 10.2912 29.8833 102
cluster_7.pdb ( medoid) 6.41569 12.0018 38.2806 77
cluster_8.pdb ( medoid) 6.15509 14.7845 39.6878 91
cluster_9.pdb ( medoid) 6.04332 13.2378 33.5717 80
cluster_10.pdb ( medoid) 5.70405 12.6226 43.3672 72