CABS-dock: 8639449e1152fa6

Project name: 8639449e1152fa6

Status: done

submitted: 2026-03-16 10:46:28, status changed: 2026-03-16 18:13:57

Project settings

Protein sequence(s)	VKSLKKEYSNENAVVKRMQSLQLDCVAVPSSRSNSATEQPGSLHSSQGLGMGPVEESWFAPSLEHPQEENEPSLQSKLQDEANYHLYGSRMDRQTKQQPRQNVAYNREEERRRRVSHDPFAQQRPYENFQNTEGKGTAYSSAASHGNAVHQPSGLTSQPQVLYQNNGLYSSHGFGTRPLDPGTAGPRVWYRPIPSHMPSLHNIPVPETNYLGNTPTMPFSSLPPTDESIKYTIYNSTGIQIGAYNYMEIGGTSSSLLDSTNTNFKEEPAAKYQAIFDNTTSLTDKHLDPIRENLGKHWKNCARKLGFTQSQIDEIDHDYERDGLKEKVYQMLQKWVMREGIKGATVGKLAQALHQCSRIDLLSSLIYVSQN input pdb
Peptide sequence	RRRGGVQLFGRRR
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCCCCCCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	20.0172	6.69425	30.7299	134
cluster_2.pdb ( medoid)	16.5979	7.89256	40.0847	131
cluster_3.pdb ( medoid)	14.8856	7.72557	37.763	115
cluster_4.pdb ( medoid)	14.193	9.30036	47.4338	132
cluster_5.pdb ( medoid)	13.9502	10.3941	39.737	145
cluster_6.pdb ( medoid)	8.33585	14.6356	33.0859	122
cluster_7.pdb ( medoid)	5.93718	15.1587	44.1892	90
cluster_8.pdb ( medoid)	3.10819	21.5559	52.0654	67
cluster_9.pdb ( medoid)	2.15715	14.8344	32.2133	32
cluster_10.pdb ( medoid)	1.61859	19.7703	38.0928	32