CABS-dock: >jg2856.t1+P27958

Project name: >jg2856.t1+P27958

Status: done

submitted: 2026-02-26 07:39:13, status changed: 2026-02-26 15:24:31

Project settings

Protein sequence(s)	APITAYAQQTRGLLGCIITSLTGRDKNQVEGEVQIVSTATQTFLATCINGVCWTVYHGAGTRTIASPKGPVIQMYTNVDQDLVGWPAPQGSRSLTPCTCGSSDLYLVTRHADVIPVRRRGDSRGSLLSPRPISYLKGSSGGPLLCPAGHAVGLFRAAVCTRGVAKAVDFIPVENLETTMRSVEGEVQIVSTATQTFLATCINGVCWTVYHGAGTRTIASPKGPVIQMYTNVDQDLVGWPAPQGSRSLTPCTCGSSDLYLVTRHADVIPVRRRGDSRGSLLSPRPISYLKGSSGGPLLCPAGHAVGLFRAAVCTRGVAKAVDFIPVENLETTMKGSVVIVGRIVLSGKPAIIPKKGSVVIVGRIVLSGKPA input pdb
Peptide sequence	LVHYHSRYRRLPSL
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCCCCCCCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	18.4443	8.94587	37.0724	165
cluster_2.pdb ( medoid)	16.412	7.55546	25.9992	124
cluster_3.pdb ( medoid)	15.9699	8.64127	35.9812	138
cluster_4.pdb ( medoid)	13.3531	11.5329	33.6005	154
cluster_5.pdb ( medoid)	13.2539	8.8276	21.7799	117
cluster_6.pdb ( medoid)	10.3665	8.00655	19.2843	83
cluster_7.pdb ( medoid)	6.80517	7.20041	27.4102	49
cluster_8.pdb ( medoid)	5.8653	11.2526	29.1446	66
cluster_9.pdb ( medoid)	4.92848	15.2177	31.6122	75
cluster_10.pdb ( medoid)	2.73093	10.6191	24.7032	29