Project name: STEAP1_PEP8-Bicyclic

Status: done

submitted: 2026-07-21 16:12:20, status changed: 2026-07-21 16:43:23

Project settings
Protein sequence(s) RRSYRYKLLNWAYQQVQQNKEDAWIEHDVWRME input pdb
Peptide sequence CPEDWLCGGCEWYDC
Simulation mc cycles50
Peptide secondary structure psipred CCCCCCCCCCCEECC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 21.1901 9.06082 33.3625 192
cluster_2.pdb ( medoid) 19.3778 3.25115 22.7926 63
cluster_3.pdb ( medoid) 16.233 6.65312 21.258 108
cluster_4.pdb ( medoid) 14.9773 5.94232 23.2705 89
cluster_5.pdb ( medoid) 13.9649 7.94851 29.9652 111
cluster_6.pdb ( medoid) 13.6078 10.9496 26.6945 149
cluster_7.pdb ( medoid) 13.1549 4.02893 20.7477 53
cluster_8.pdb ( medoid) 8.70967 10.7926 26.7056 94
cluster_9.pdb ( medoid) 5.57733 12.7301 26.0805 71
cluster_10.pdb ( medoid) 4.86067 14.4013 26.6537 70