Project name: RBX1_binder7

Status: done

submitted: 2026-03-21 23:15:48, status changed: 2026-03-22 01:53:56

Project settings
Protein sequence(s) MAAAMDVDTPSGTNSGAGKKRFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWEFQKYGH input pdb
Peptide sequence YTDDGETLMEEALRQQELEQRDTICYRN
Simulation mc cycles50
Peptide secondary structure psipred CCCHHHHHHHHHHHHHHHHHHHCCCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 23.0131 5.17096 26.525 119
cluster_2.pdb ( medoid) 18.5118 6.0502 26.528 112
cluster_3.pdb ( medoid) 15.5758 12.5194 36.4679 195
cluster_4.pdb ( medoid) 9.31594 9.01681 27.5361 84
cluster_5.pdb ( medoid) 9.28961 9.15 29.2437 85
cluster_6.pdb ( medoid) 8.30177 12.5275 31.8291 104
cluster_7.pdb ( medoid) 6.18572 14.873 36.5212 92
cluster_8.pdb ( medoid) 5.59758 16.4357 29.8457 92
cluster_9.pdb ( medoid) 4.6585 13.309 26.7111 62
cluster_10.pdb ( medoid) 2.94732 18.661 31.4926 55