Project name: 1234

Status: done

submitted: 2026-04-20 13:54:53, status changed: 2026-04-20 18:00:32

Project settings
Protein sequence(s) NTTVFQGVAGQSLQVSCPYDSMKHWGRRKAWCRQLGEKGPCQRVVSTHNLWLLSFLRRWNGSTAITDDTLGGTLTITLRNLQPHDAGLYQCQSLHGSEADTLRKVLVEVLADNTTVFQGVAGQSLQVSCPYDSMKHWGRRKAWCRQLGEKGPCQRVVSTHNLWLLSFLRRWNGSTAITDDTLGGTLTITLRNLQPHDAGLYQCQSLHGSEADTLRKVLVEVLAD input pdb
Peptide sequence GPSPPPMAGGCGR
Simulation mc cycles50
Peptide secondary structure psipred CCCCCCCCCCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 53.2113 3.64584 10.6907 194
cluster_2.pdb ( medoid) 42.8353 1.91431 4.57384 82
cluster_3.pdb ( medoid) 30.3885 4.14631 18.2799 126
cluster_4.pdb ( medoid) 23.8624 3.98116 16.4454 95
cluster_5.pdb ( medoid) 20.6796 5.12581 15.1248 106
cluster_6.pdb ( medoid) 14.3978 4.72293 10.531 68
cluster_7.pdb ( medoid) 11.0004 10.7269 38.0468 118
cluster_8.pdb ( medoid) 9.79343 12.6615 40.5468 124
cluster_9.pdb ( medoid) 4.05357 14.3084 46.3467 58
cluster_10.pdb ( medoid) 2.44931 11.8401 48.0123 29