CABS-dock: 913cce5ef3be327

Project name: 913cce5ef3be327

Status: done

submitted: 2025-04-22 12:16:24, status changed: 2025-04-22 18:53:03

Project settings

Protein sequence(s)	AESQPDPMPDDLHKSSEFTGTMGNMKYLYDDHYVSATKVKSVDSFFKWDLIYNISDKKLKNYDKVKTELLNEDLAKKYKDEVVDVYGSNYYVNCYFSSKGGKTCMYGGITKHEGNHFDNGNLQNVLVRVYENKRNTISFEVQTDKKSVTAQELDIKARNFLINKKNLYEFNSSPYETGYIKFIENNGNTFWYDMMPAPGDKFDQSKYLMMYNDNKTVDSKSVKIEVHLTTKNG input pdb
Peptide sequence	SVGEGGAAAENAGIN
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCHHHHHHHCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	18.8397	7.48419	29.0864	141
cluster_2.pdb ( medoid)	16.6183	8.48462	35.5059	141
cluster_3.pdb ( medoid)	16.266	8.91428	28.3039	145
cluster_4.pdb ( medoid)	16.0011	6.62455	19.2255	106
cluster_5.pdb ( medoid)	15.6981	6.81612	31.7627	107
cluster_6.pdb ( medoid)	11.0803	10.7398	30.0301	119
cluster_7.pdb ( medoid)	6.68915	10.4647	27.5577	70
cluster_8.pdb ( medoid)	5.62618	13.686	42.4674	77
cluster_9.pdb ( medoid)	3.57223	12.8771	38.6325	46
cluster_10.pdb ( medoid)	3.49467	13.7352	40.7654	48