Project name: SYTNSQHQSS-YW

Status: done

submitted: 2026-07-23 08:46:25, status changed: 2026-07-23 12:53:03

Project settings
Protein sequence(s) GTFLAYAQFNDTEVPLIEYSFYSDESLQYPKTVRVPYPKAGAVNPTVKFFVVNTDSLSSVTNATSIQITAPASMLIGDHYLCDVTWATQERISLQWLRRIQNYSVMDICDYDESSGRWNCLVARQHIEMSTTGWVGRFRPS input pdb
Peptide sequence SYTNSQHQSS
Simulation mc cycles100
Peptide secondary structure psipred CCCCCCCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 40.7695 3.1396 16.3702 128
cluster_2.pdb ( medoid) 29.0224 5.92645 25.7722 172
cluster_3.pdb ( medoid) 28.6612 7.15253 22.4771 205
cluster_4.pdb ( medoid) 15.8638 6.11454 19.0175 97
cluster_5.pdb ( medoid) 14.9856 7.54055 18.392 113
cluster_6.pdb ( medoid) 10.7254 9.04398 37.9276 97
cluster_7.pdb ( medoid) 10.2858 6.12492 13.4707 63
cluster_8.pdb ( medoid) 9.08452 6.38449 16.8121 58
cluster_9.pdb ( medoid) 5.2833 5.48899 10.7333 29
cluster_10.pdb ( medoid) 2.29548 16.5543 34.396 38